PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000264.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 380aa    MW: 42614.5 Da    PI: 6.6564
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000264.1_g00019.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.1e-51111471128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..........kvka.eekewyfFskrdkkyatgkrkn 75 
                              +ppGfrFhPt+eel+++yL+kkv+++k++l +vi++vd++k+ePwd++           k+ +  +++wyfFs++dkky+tg+r+n
  Itr_sc000264.1_g00019.1  11 VPPGFRFHPTEEELLHYYLRKKVTSEKIDL-DVIRDVDLNKLEPWDIQGnvamcvsekcKIGSgPQNDWYFFSHKDKKYPTGTRTN 95 
                              69****************************.9***************94478888776544443456******************* PP

                      NAM  76 ratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              rat++g+Wkatg+dk ++s + + +g++ktLvfykgrap+g+k+dW+mheyrl
  Itr_sc000264.1_g00019.1  96 RATAAGFWKATGRDKVIYS-NCKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 147
                              *******************.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-568179IPR003441NAC domain
PROSITE profilePS5100555.2111179IPR003441NAC domain
PfamPF023651.2E-2712147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MNLSVNGQSQ VPPGFRFHPT EEELLHYYLR KKVTSEKIDL DVIRDVDLNK LEPWDIQGNV  60
AMCVSEKCKI GSGPQNDWYF FSHKDKKYPT GTRTNRATAA GFWKATGRDK VIYSNCKRIG  120
MRKTLVFYKG RAPHGQKSDW IMHEYRLDDN YPEPTGTSLV GELNSAPEEG WVVCRVFKKK  180
NYHKALESPH TVVQTHPGND GVLDQILTYM GRSSSSSKQQ NGAKNGNLII NGDDTPMQFS  240
HAIQAARFLH LPPLETQSAM EILSSPTHAS FEDMLTEPEP SCNNTEPVDD MKTGPGPADW  300
VALDRLVASQ LNGQIESSKS YVADDLSDGL YFPIVDHHRP FGRPNNHHHN SQVNAGNEVE  360
FWSYTNSSSS PSDPLSHLSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-44818114167NO APICAL MERISTEM PROTEIN
1ut4_B1e-44818114167NO APICAL MERISTEM PROTEIN
1ut7_A1e-44818114167NO APICAL MERISTEM PROTEIN
1ut7_B1e-44818114167NO APICAL MERISTEM PROTEIN
3swm_A1e-44818117170NAC domain-containing protein 19
3swm_B1e-44818117170NAC domain-containing protein 19
3swm_C1e-44818117170NAC domain-containing protein 19
3swm_D1e-44818117170NAC domain-containing protein 19
3swp_A1e-44818117170NAC domain-containing protein 19
3swp_B1e-44818117170NAC domain-containing protein 19
3swp_C1e-44818117170NAC domain-containing protein 19
3swp_D1e-44818117170NAC domain-containing protein 19
4dul_A1e-44818114167NAC domain-containing protein 19
4dul_B1e-44818114167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506449.11e-153PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-114NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1AVV21e-142M1AVV2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000315711e-142(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-104NAC family protein